compound 6a [PMID: 18942826] [Ligand Id: 8744] activity data from GtoPdb and ChEMBL

Click here for a description of the charts and data table

Please tell us if you are using this feature and what you think!

ChEMBL ligand: CHEMBL316034 (2,4-Pyridine Dicarboxylic Acid, Pyridine-2,4-Dicarboxylic Acid)
  • Alpha-ketoglutarate-dependent dioxygenase FTO in Human [ChEMBL: CHEMBL2331065] [UniProtKB: Q9C0B1]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • egl-9 family hypoxia inducible factor 1/Egl nine homolog 1 in Human [ChEMBL: CHEMBL5697] [GtoPdb: 2833] [UniProtKB: Q9GZT9]
There should be some charts here, you may need to enable JavaScript!
  • egl-9 family hypoxia inducible factor 3/Egl nine homolog 3 in Human [ChEMBL: CHEMBL5705] [GtoPdb: 2834] [UniProtKB: Q9H6Z9]
There should be some charts here, you may need to enable JavaScript!
  • Hypoxia-inducible factor 1-alpha inhibitor in Human [ChEMBL: CHEMBL5909] [UniProtKB: Q9NWT6]
There should be some charts here, you may need to enable JavaScript!
  • egl-9 family hypoxia inducible factor 2/Hypoxia-inducible factor prolyl hydroxylase 1 in Human [ChEMBL: CHEMBL3028] [GtoPdb: 2832] [UniProtKB: Q96KS0]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 2A/Lysine-specific demethylase 2A in Human [ChEMBL: CHEMBL1938210] [GtoPdb: 2671] [UniProtKB: Q9Y2K7]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 3A/Lysine-specific demethylase 3A in Human [ChEMBL: CHEMBL1938209] [GtoPdb: 2673] [UniProtKB: Q9Y4C1]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 4A/Lysine-specific demethylase 4A in Human [ChEMBL: CHEMBL5896] [GtoPdb: 2675] [UniProtKB: O75164]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 4C/Lysine-specific demethylase 4C in Human [ChEMBL: CHEMBL6175] [GtoPdb: 2677] [UniProtKB: Q9H3R0]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 4D/Lysine-specific demethylase 4D in Human [ChEMBL: CHEMBL6138] [GtoPdb: 2678] [UniProtKB: Q6B0I6]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 4E/Lysine-specific demethylase 4D-like in Human [ChEMBL: CHEMBL1293226] [GtoPdb: 2679] [UniProtKB: B2RXH2]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 5A/Lysine-specific demethylase 5A in Human [ChEMBL: CHEMBL2424504] [GtoPdb: 2680] [UniProtKB: P29375]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 5B/Lysine-specific demethylase 5B in Human [ChEMBL: CHEMBL3774295] [GtoPdb: 2681] [UniProtKB: Q9UGL1]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 5C/Lysine-specific demethylase 5C in Human [ChEMBL: CHEMBL2163176] [GtoPdb: 2682] [UniProtKB: P41229]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 6B/Lysine-specific demethylase 6B in Human [ChEMBL: CHEMBL1938211] [GtoPdb: 2685] [UniProtKB: O15054]
There should be some charts here, you may need to enable JavaScript!
  • lysine demethylase 7A/Lysine-specific demethylase 7 in Human [ChEMBL: CHEMBL2163177] [GtoPdb: 2686] [UniProtKB: Q6ZMT4]
There should be some charts here, you may need to enable JavaScript!
  • Prolyl 4-hydroxylase in Paramecium bursaria Chlorella virus 1 [ChEMBL: CHEMBL4523368] [UniProtKB: Q84406]
There should be some charts here, you may need to enable JavaScript!
DB Assay description Assay Type Standard value Standard parameter Original value Original units Original parameter Reference
Alpha-ketoglutarate-dependent dioxygenase FTO in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2331065] [UniProtKB: Q9C0B1]
ChEMBL Inhibition of human hexahistidine-tagged full-length FTO expressed in Escherichia coli BL21 (DE3) using 3-methylthymidine as substrate assessed as inhibition of 3-methylthymidine conversion to thymidine after 1 hr by liquid chromatographic analysis B 5.08 pIC50 8300 nM IC50 J Med Chem (2013) 56: 3680-3688 [PMID:23547775]
Aspartyl/asparaginyl beta-hydroxylase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4680030] [UniProtKB: Q12797]
ChEMBL Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with high 200 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis B 7 pIC50 100 nM IC50 Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
ChEMBL Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with 3 uM 2OG, 100 uM L-ascorbic acid and high 20 uM FAS incubated for 35 mins by MS analysis B 7.52 pIC50 30 nM IC50 Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
ChEMBL Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using 1 uM hFX-CP as substrate mixture with 3 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis B 7.7 pIC50 20 nM IC50 Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
ChEMBL Inhibition of N-His6-tagged human AspH (315-755) expressed in Escherichia coli BL21 (DE3) using high 10 uM hFX-CP as substrate mixture with 10 uM 2OG, 100 uM L-ascorbic acid and 2 uM FAS incubated for 35 mins by MS analysis B 7.7 pIC50 20 nM IC50 Bioorg Med Chem (2020) 28: 115675-115675 [PMID:33069066]
Beta-lactamase in Aeromonas hydrophila (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3885662] [UniProtKB: Q44079]
ChEMBL Inhibition of Aeromonas hydrophila beta lactamase CphA at pH 8.0 B 4.46 pKi 35000 nM Ki Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979]
ChEMBL Inhibition of Aeromonas hydrophila beta lactamase CphA at pH 7.0 B 4.77 pKi 17000 nM Ki Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979]
ChEMBL Inhibition of Aeromonas hydrophila beta lactamase CphA by competitive inhibition assay B 5.35 pKi 4500 nM Ki Antimicrob Agents Chemother (2007) 51: 2136-2142 [PMID:17307979]
egl-9 family hypoxia inducible factor 1/Egl nine homolog 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5697] [GtoPdb: 2833] [UniProtKB: Q9GZT9]
ChEMBL Binding affinity to human PHD2 catalytic domain (181 to 426) Mn2 expressed in Escherichia coli by NMR spectroscopic analysis B 6.38 pKd 420 nM Kd J Med Chem (2013) 56: 547-555 [PMID:23234607]
ChEMBL Inhibition of human recombinant PHD2 B 5.15 pKi 7000 nM Ki J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
ChEMBL Inhibition of recombinant human PHD2 using 2OG as substrate and Fe2 as co-factor assessed as hydroxylation incubated for 15 mins in presence of L-ascorbate by LC-MS analysis B 5.15 pIC50 7000 nM IC50 Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136]
ChEMBL Inhibition of human recombinant PHD2 expressed in Sf9 cells by time-resolved fluorescence assay B 5.21 pIC50 6100 nM IC50 J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
ChEMBL Inhibition of human PHD2 catalytic domain (181 to 426) Mn2 expressed in Escherichia coli by NMR spectroscopic analysis B 5.7 pIC50 2000 nM IC50 J Med Chem (2013) 56: 547-555 [PMID:23234607]
egl-9 family hypoxia inducible factor 3/Egl nine homolog 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5705] [GtoPdb: 2834] [UniProtKB: Q9H6Z9]
ChEMBL Inhibition of human recombinant HIF PHD3 B 5.15 pKi 7000 nM Ki J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
Hypoxia-inducible factor 1-alpha inhibitor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5909] [UniProtKB: Q9NWT6]
ChEMBL Inhibition of N-terminal His6-tagged full-length FIH (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay B 5.07 pIC50 8600 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
egl-9 family hypoxia inducible factor 2/Hypoxia-inducible factor prolyl hydroxylase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3028] [GtoPdb: 2832] [UniProtKB: Q96KS0]
ChEMBL Inhibition of human recombinant HIF PHD1 B 5.15 pKi 7000 nM Ki J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
ChEMBL Inhibition of human recombinant PHD1 expressed in Sf9 cells by time-resolved fluorescence assay B 5.82 pIC50 1500 nM IC50 J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
lysine demethylase 2A/Lysine-specific demethylase 2A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938210] [GtoPdb: 2671] [UniProtKB: Q9Y2K7]
ChEMBL Inhibition of KDM2A (unknown origin) expressed in Escherichia coli using Biotin H3 (28 to 48 residues) Me2 KDM2A Cognate Ligande/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 30 mins by alphascreen assay B 4.89 pIC50 12800 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Inhibition of KDM2A (unknown origin) B 5.39 pIC50 4100 nM IC50 J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
ChEMBL Inhibition of KDM2A (unknown origin) B 5.4 pIC50 3981.07 nM IC50 Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
lysine demethylase 3A/Lysine-specific demethylase 3A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938209] [GtoPdb: 2673] [UniProtKB: Q9Y4C1]
ChEMBL Inhibition of KDM3A (unknown origin) B 5.1 pIC50 7943.28 nM IC50 Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
ChEMBL Inhibition of KDM3A (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me2-GGK-Biotin KDM3A Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay B 5.48 pIC50 3300 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 4A/Lysine-specific demethylase 4A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5896] [GtoPdb: 2675] [UniProtKB: O75164]
ChEMBL Inhibition of recombinant His-tagged JMJD2A expressed in Escherichia coli Rosetta 2 (DE3) pLysS cells by formaldehyde dehydrogenase-coupled assay B 5.38 pIC50 4200 nM IC50 J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
ChEMBL Inhibition of KDM4A (unknown origin) using H3K9me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay B 5.38 pIC50 4200 nM IC50 J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
GtoPdb FDH (formaldehyde dehydrogenase) coupled assay. - 6.15 pIC50 700 nM IC50 J Med Chem (2008) 51: 7053-6 [PMID:18942826]
ChEMBL Inhibition of human JMJD2A by FDH coupled assay B 6.15 pIC50 700 nM IC50 J Med Chem (2008) 51: 7053-7056 [PMID:18942826]
lysine demethylase 4C/Lysine-specific demethylase 4C in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6175] [GtoPdb: 2677] [UniProtKB: Q9H3R0]
ChEMBL Inhibition of KDM4C catalytic core-mediated demethylation of ARK(Me)3STGGK after 30 mins by FDH-coupled assay B 4.89 pKi 13000 nM Ki Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519]
ChEMBL Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARK(Me3)STGGK peptide/alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis B 8.66 pKi 2.2 nM Ki J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Inhibition of KDM4C catalytic core-mediated demethylation of ARK(Me)3STGGK after 30 mins by FDH-coupled assay B 4.41 pIC50 39000 nM IC50 Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519]
ChEMBL Inhibition of recombinant His-tagged JMJD2C expressed in Escherichia coli Rosetta 2 (DE3) pLysS cells by formaldehyde dehydrogenase-coupled assay B 5.03 pIC50 9400 nM IC50 J Med Chem (2010) 53: 5629-5638 [PMID:20684604]
ChEMBL Inhibition of KDM4C (unknown origin) using H3K9me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay B 5.09 pIC50 8200 nM IC50 J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
ChEMBL Inhibition of KDM4C (unknown origin) B 5.6 pIC50 2511.89 nM IC50 Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
ChEMBL Inhibition of KDM4C B 5.62 pIC50 2400 nM IC50 Bioorg Med Chem Lett (2012) 22: 5811-5813 [PMID:22917519]
ChEMBL Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 250 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis B 5.72 pIC50 1900 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/50 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis B 5.82 pIC50 1500 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated peptide/ 2 uM alpha-ketoglutarate as substrate/cofactor preincubated for 15 mins followed by substrate addition measured after 15 mins by alphascreen assay B 5.92 pIC50 1200 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using ARTKQTARK(Me3)STGGKA peptide/100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay B 6.21 pIC50 620 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Competitive inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using 50 uM ARK(Me3)STGGK peptide/5 uM alpha-ketoglutarate as substrate/cofactor by FDH coupling-based Lineweaver-Burk plot analysis B 6.28 pIC50 530 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Inhibition of N-terminal His6-tagged KDM4C (1 to 352 residues) (unknown origin) expressed in Escherichia coli Rosetta 2(DE3)pLysS using biotinylated histone H3 (1 to 21 residues) lysine 9 trimethylated peptide/2 uM alpha-ketoglutarate as substrate/cofactor measured after 45 mins by TR-FRET assay B 6.73 pIC50 188 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 4D/Lysine-specific demethylase 4D in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6138] [GtoPdb: 2678] [UniProtKB: Q6B0I6]
ChEMBL Inhibition of KDM4D (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K9Me3-GGK-Biotin KDM4 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay B 5.62 pIC50 2400 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 4E/Lysine-specific demethylase 4D-like in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1293226] [GtoPdb: 2679] [UniProtKB: B2RXH2]
ChEMBL Inhibition of KDM4E (unknown origin) B 5.2 pIC50 6309.57 nM IC50 Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
GtoPdb FDH (formaldehyde dehydrogenase) coupled assay. - 5.85 pIC50 1400 nM IC50 J Med Chem (2008) 51: 7053-6 [PMID:18942826]
lysine demethylase 5A/Lysine-specific demethylase 5A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2424504] [GtoPdb: 2680] [UniProtKB: P29375]
ChEMBL Inhibition of KDM5A (unknown origin) using H3K4me3 peptide and 2-oxoglutarate as substrate after 1 hr by FDH-coupled assay B 4 pIC50 100000 nM IC50 J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
ChEMBL Inhibition of KDM5A (1 to 797 residues) (unknown origin) expressed in insect sf21 cells using ARTK(Me3)QTARKSTGGKAPRK peptide/ 100 uM alpha-ketoglutarate as substrate/cofactor incubated for 45 mins by MALDI assay B 6.12 pIC50 760 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 5B/Lysine-specific demethylase 5B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3774295] [GtoPdb: 2681] [UniProtKB: Q9UGL1]
ChEMBL Inhibition of recombinant KDM5B catalytic domain (1 to 769 residues) (unknown origin) B 5.52 pIC50 3000 nM IC50 Eur J Med Chem (2019) 161: 131-140 [PMID:30343192]
ChEMBL Inhibition of KDM5B (unknown origin) expressed in Escherichia coli using H3 (1 to 21 residues) K4Me3-GGK-Biotin KDM5B Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 20 mins by alphascreen assay B 5.57 pIC50 2700 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
lysine demethylase 5C/Lysine-specific demethylase 5C in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163176] [GtoPdb: 2682] [UniProtKB: P41229]
ChEMBL Inhibition of KDM5C (unknown origin) B 6.3 pIC50 501.19 nM IC50 Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
lysine demethylase 6B/Lysine-specific demethylase 6B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938211] [GtoPdb: 2685] [UniProtKB: O15054]
ChEMBL Inhibition of KDM6B (unknown origin) expressed in Escherichia coli using H3 (21 to 44 residues) K27Me3-GGK-Biotin JMJD3 Cognate Ligand/10 uM alpha-ketoglutarate as substrate/cofactor preincubated for 5 mins followed by substrate addition measured after 5 mins by alphascreen assay B 4.35 pIC50 44600 nM IC50 J Med Chem (2016) 59: 1580-1598 [PMID:26699912]
ChEMBL Inhibition of KDM6B (unknown origin) B 4.5 pIC50 31622.78 nM IC50 Medchemcomm (2014) 5: 1879-1886 [PMID:26682034]
lysine demethylase 7A/Lysine-specific demethylase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2163177] [GtoPdb: 2686] [UniProtKB: Q6ZMT4]
ChEMBL Inhibition of KDM7A (unknown origin) using K27me2 peptide as substrate by MALDI assay B 4.82 pIC50 15000 nM IC50 J Med Chem (2013) 56: 7222-7231 [PMID:23964788]
Prolyl 4-hydroxylase in Paramecium bursaria Chlorella virus 1 (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523368] [UniProtKB: Q84406]
ChEMBL Inhibition of N-terminal His6-tagged recombinant Paramecium bursaria chlorella virus 1 CPH expressed in Escherichia coli Rosetta 2 (DE3) cells pre-incubated for 5 mins before 2OG as substrate and Fe2 as co-factor addition in presence of L-ascorbate and measured after 5 mins MALDI TOF MS analysis B 5.48 pKi 3280 nM Ki Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136]
ChEMBL Inhibition of N-terminal His6-tagged recombinant Paramecium bursaria chlorella virus 1 CPH expressed in Escherichia coli Rosetta 2 (DE3) cells pre-incubated for 5 mins before 2OG as substrate and Fe2 as co-factor addition in presence of L-ascorbate and measured after 5 mins MALDI TOF MS analysis B 5.28 pIC50 5300 nM IC50 Bioorg Med Chem (2019) 27: 2405-2412 [PMID:30737136]

ChEMBL data shown on this page come from version 33:

Mendez D, Gaulton A, Bento AP, Chambers J, De Veij M, Félix E, Magariños MP, Mosquera JF, Mutowo P, Nowotka M, Gordillo-Marañón M, Hunter F, Junco L, Mugumbate G, Rodriguez-Lopez M, Atkinson F, Bosc N, Radoux CJ, Segura-Cabrera A, Hersey A, Leach AR. (2019) 'ChEMBL: towards direct deposition of bioassay data' Nucleic Acids Res., 47(D1). DOI: 10.1093/nar/gky1075. [EPMCID:30398643]
Davies M, Nowotka M, Papadatos G, Dedman N, Gaulton A, Atkinson F, Bellis L, Overington JP. (2015) 'ChEMBL web services: streamlining access to drug discovery data and utilities.' Nucleic Acids Res., 43(W1). DOI: 10.1093/nar/gkv352. [EPMCID:25883136]