liraglutide

Ligand id: 1133

Name: liraglutide

Structure and Physico-chemical Properties

2D Structure
Peptide Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly
Chemical Modification
Amide bridge formed between lysine residue at position 20 and a glutamamic acid residue
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel