exendin-4

Ligand id: 1135

Name: exendin-4

Peptide Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
Post-translational Modification
Amidation of C-terminal serine residue