Ligand Id: 2306
Ligand name BmP09


Summary Biological activity References Structure Similar ligands
Peptide Sequence
DNGYLLNKYTGCKIWCVINNESCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYETNKCNGKM
Asp-Asn-Gly-Tyr-Leu-Leu-Asn-Lys-Tyr-Thr-Gly-Cys-Lys-Ile-Trp-Cys-Val-Ile-Asn-Asn-Glu-Ser-Cys-Asn-Ser-Glu-Cys-Lys-Leu-Arg-Arg-Gly-Asn-Tyr-Gly-Tyr-Cys-Tyr-Phe-Trp-Lys-Leu-Ala-Cys-Tyr-Cys-Glu-Gly-Ala-Pro-Lys-Ser-Glu-Leu-Trp-Ala-Tyr-Glu-Thr-Asn-Lys-Cys-Asn-Gly-Lys-Met
Search for 3D structures on the PDB
Search by keyword: BmP09 Search by accession number: Q9UAC8
Post-translational Modification
Disulphide bonds between cysteine residues at positions 12 and 62, 16 and 37, 23 and 44, and 27 and 46
Download 2D Structure
No information available.

Disclaimer: Peptide pages are currently under development, please exercise caution over the use of sequence and structural information provided here. Please send notification of errors to curators@iuphar-db.org.