ErgTx-1

Ligand id: 2612

Name: ErgTx-1

Peptide Sequence
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala
Post-translational Modification
Disulphide bonds between cysteine residues at positions 5 and 23, 11 and 34, 20 and 39, and 24 and 41.