ACTH

Ligand id: 3633

Name: ACTH

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: acth

Peptide Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Post-translational Modification
None.