[125I]CCL17 (human)

Ligand id: 3652

Name: [125I]CCL17 (human)    

Peptide Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Ala-Arg-Gly-Thr-Asn-Val-Gly-Arg-Glu-Cys-Cys-Leu-Glu-Tyr-Phe-Lys-Gly-Ala-Ile-ProLeu-Arg-Lys-Leu-Lys-Thr-Trp-Tyr-Gln-Thr-Ser-Glu-Asp-Cys-Ser-Arg-Asp-Ala-Ile-Val-Phe-Val-Thr-Val-Gln-Gly-Arg-Ala-Ile-Cys-Ser-Asp-Pro-Asn-Asn-Lys-Arg-Val-Lys-Asn-Ala-Val-Lys-Tyr-Leu-Gln-Ser-Leu-Glu-Arg-Ser