Dickkopf 1   Click here for help

GtoPdb Ligand ID: 3701

Synonyms: Dickkopf-related protein 1 | DKK 1
Compound class: Endogenous peptide in human, mouse or rat
Comment: DKK1 is a secreted protein that inhibits canonical Wnt/β-catenin signalling via interaction with the LRP5/LRP6 co-receptor. It is involved in normal biological processes such as embryonic development and bone homeostasis [5]. In the cancer setting DKK1 promotes an immunosuppressive tumour microenvironment [3,6], and is associated with cancer cell proliferation, invasion, and tumour growth [1,4]. Neutralising DKK1 function is being investigated as an oncology therapeutic strategy.
Species: Human
Peptide Sequence Click here for help
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQIC
LACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLR
SSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Post-translational Modification
Asparagine residue at position 225 is N-linked glycosylated; O-linked glycosylation of serine residue at position 40. Disulfide bond formation between cysteine residues at positions 158 and 170; 164 and 179; 169 and 206; 189 and 214; 208 and 232