Synonyms: H1 relaxin (B chain)
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Is a component of |
relaxin-1 |
Peptide Sequence | |
VAAKWKDDVIKLCGRELVRAQIAICGMSTWS | |
Val-Ala-Ala-Lys-Trp-Lys-Asp-Asp-Val-Ile-Lys-Leu-Cys-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Cys-Gly-Met-Ser-Thr-Trp-Ser |
Post-translational Modification | |
Fully active H1 relaxin is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 35) and A chain (residue 172), and the second between B chain (residue 47) and A chain (residue 185). |