Ligand Id: 3768
Ligand name [125I]AM (rat)


Summary Biological activity References Structure Similar ligands Radio analogues
Peptide Sequence
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY
Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Search for 3D structures on the PDB
Search by keyword: [125I]AM (rat)
Download 2D Structure
No information available.

Disclaimer: Peptide pages are currently under development, please exercise caution over the use of sequence and structural information provided here. Please send notification of errors to curators@iuphar-db.org.