| Ligand Id: 3848 |
| Ligand name |
[Pro34]NPY
|
Peptide Sequence  |
|
YPSKPPNPGEDAPAEDMARYYSALRHYINLITRQRY
|
|
Tyr-Pro-Ser-Lys-Pro-Pro-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
|
| Search for 3D structures on the PDB |
|
Search by keyword:
[Pro34]NPY
|
|
| Download 2D Structure |
| No information available. |
|
|
Disclaimer: Peptide pages are currently under development, please exercise caution over the use of sequence and structural information provided here. Please send notification of errors to curators@iuphar-db.org.
@GuidetoPHARM 
Like us on Facebook