glycoprotein hormone common alpha subunit

Home
Ligands
glycoprotein hormone common alpha subunit (Mouse)

GtoPdb Ligand ID: 4377

Compound class: Endogenous peptide in human, mouse or rat

Species: Mouse

Is a component of
FSH
LH
TSH

Is a component of

FSH

TSH

Peptide Sequence
LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARV ENHTECHCSTCYYHKS
Leu-Pro-Asp-Gly-Asp-Phe-Ile-Ile-Gln-Gly-Cys-Pro-Glu-Cys-Lys-Leu-Lys-Glu-Asn-Lys-Tyr-Phe-Ser-Lys-Leu-Gly-Ala-Pro-Ile-Tyr-Gln-Cys-Met-Gly-Cys-Cys-Phe-Ser-Arg-Ala-Tyr-Pro-Thr-Pro-Ala-Arg-Ser-Lys-Lys-Thr-Met-Leu-Val-Pro-Lys-Asn-Ile-Thr-Ser-Glu-Ala-Thr-Cys-Cys-Val-Ala-Lys-Ala-Phe-Thr-Lys-Ala-Thr-Val-Met-Gly-Asn-Ala-Arg-Val-Glu-Asn-His-Thr-Glu-Cys-His-Cys-Ser-Thr-Cys-Tyr-Tyr-His-Lys-Ser

Post-translational Modification
The production of biologically active FSH, LH and TSH requires the FSHβ, LHβ and TSHβ subunits and the common α subunit to assemble to form the heterodimeric hormone. The common alpha subunit is glycosylated at asparagine residues 56 and 82, with disulfide bond formation between cysteine residues at positions 11 and 35; 14 and 64; 32 and 86; 36 and 88 and 63 and 91. It then assembles with the various β subunits to form the biologically active FSH, LH and TSH heterodimers.

Post-translational Modification

The production of biologically active FSH, LH and TSH requires the FSHβ, LHβ and TSHβ subunits and the common α subunit to assemble to form the heterodimeric hormone. The common alpha subunit is glycosylated at asparagine residues 56 and 82, with disulfide bond formation between cysteine residues at positions 11 and 35; 14 and 64; 32 and 86; 36 and 88 and 63 and 91. It then assembles with the various β subunits to form the biologically active FSH, LH and TSH heterodimers.