teriparatide

Ligand id: 4448

Name: teriparatide

Peptide Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe