thrombin heavy chain   Click here for help

GtoPdb Ligand ID: 4455

Synonyms: thrombin B chain (mouse)
Species: Mouse
Is a component of
Peptide Sequence Click here for help
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLVRIGKHSRTRYERNVEKISM
LEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVL
QVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFY
THVFRLKRWIQKVIDQFG
Post-translational Modification
Active mouse thrombin is a complex between thrombin light chain and thrombin heavy chain. The chains are linked by a disulphide bond between cysteine residues at position 9 of the light chain and 155 of the heavy chain.

The heavy chain exhibits disulphide bond formation between cysteine residues at positions 28 and 44, 173 and 187, and 201 and 231; N-linked glycosylation of asparagine residues at positions 53 and 193