protein C light chain

Home
Ligands
protein C light chain (Human)

GtoPdb Ligand ID: 4474

Compound class: Endogenous peptide in human, mouse or rat

Species: Human

Summary
Biological activity
Structure
Similar ligands

Is a component of
protein C

Is a component of

protein C

Peptide Sequence
ANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDC RSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL

Post-translational Modification
Carboxylation of glutamate residues at positions 6, 7, 14, 16, 19, 20, 25, 26, 29, 71 and 97. Disulphide bonds between cysteine residues at positions 17 and 22, 50 and 69, 59 and 64, 63 and 78, 80 and 89, 98 and 109, 105 and 118, and 140 and 133. N-linked glycosylation of asparagine residue at position 97. Protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 120 of the heavy chain

Post-translational Modification

Carboxylation of glutamate residues at positions 6, 7, 14, 16, 19, 20, 25, 26, 29, 71 and 97. Disulphide bonds between cysteine residues at positions 17 and 22, 50 and 69, 59 and 64, 63 and 78, 80 and 89, 98 and 109, 105 and 118, and 140 and 133. N-linked glycosylation of asparagine residue at position 97.

Protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 120 of the heavy chain