protein C light chain   Click here for help

GtoPdb Ligand ID: 4477

Compound class: Endogenous peptide in human, mouse or rat
Species: Mouse
Is a component of
protein C
Peptide Sequence Click here for help
ANSFLEEMRPGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPPLDHQCDSPCCGHGTCIDGIGSFSCSC
DKGWEGKFCQQELRFQDCRVNNGGCLHYCLEESNGRRCACAPGYELADDHMRCKSTVNFPCGKLGRWIEKKRKIL
Post-translational Modification
Mouse protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 121 of the heavy chain