Synonyms: BMP11 | bone morphogenetic protein 11 | GDF-11
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence | |
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMS PINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Post-translational Modification | |
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 73 of each chain. Predicted disulphide bond formation between cysteine residues at positions 15 and 74, 43 and 106, and 47 and 108 |