growth/differentiation factor-5   Click here for help

GtoPdb Ligand ID: 4879

Abbreviated name: GDF5
Synonyms: BMP-14 | bone morphogenetic protein 14 | cartilage-derived morphogenetic protein 1 (CDMP-1) | growth/differentiation factor 5 (GDF-5) | radotermin
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPEST
PPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Selected 3D Structures
PDB Id: 1WAQ
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 84 of each chain. Disulphide bond formation between cysteine residues at positions 19 and 85, 48 and 117, and 52 and 119