Abbreviated name: EFNA2
Synonyms: EPH-related receptor tyrosine kinase ligand 6 | HEK7 ligand | HEK7-L
Compound class:
Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
|
Peptide Sequence | |
RAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDH RQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPI FTSN |
Selected 3D Structures | ||
|
Post-translational Modification | |
Disulphide bond formation between cysteine residues at positions 49 and 90, and 78 and 139. Predicted amidation of C-terminal asparagine residue; predicted N-linked glycosylation of asparagine residues at positions 18, 150 and 164 |