|
Abbreviated name: EFNA5
Synonyms: AL-1 | EPH-related receptor tyrosine kinase ligand 7 | LERK-7
Compound class:
Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
|
Peptide Sequence  |
|
|
QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRW ECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK VENSLEPADDTVHESAEPSRGEN |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Predicted disulphide bond formation between cysteine residues at positions 42 and 82, and 70 and 131. Predicted amidation of C-terminal asparagine residue; predicted N-linked glycosylation of asparagine residue at position 17 | |
