erythropoietin

Ligand id: 4921

Name: erythropoietin

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: erythropoietin

Peptide Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAL
LVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEA
CRTGDR
Selected 3D Structures
PDB Id: 1BUY
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine residues at positions 24, 38, and 83; O-linked glycosylation of serine at position 126; disulphide bond formation between cysteine residues at positions 7 and 161, and 29 and 33