G-CSF

Ligand id: 4934

Name: G-CSF

Species: Human

Peptide Sequence
ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLS
QLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASH
LQSFLEVSYRVLRHLAQP
Selected 3D Structures
PDB Id: 1RHG
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted O-linked glycosylation of threonine at position 137; disulphide bond formation between cysteine residues at positions 40 and 46, and 68 and 78