Abbreviated name: GDF1
Synonyms: embryonic growth/differentiation factor 1 | GDF-1
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence | |
DAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQCALPVALSGSGGPPALNHAVLRALMHAAAPGAAD LPCCVPARLSPISVLFFDNSDNVVLRQYEDMVVDECGCR |
Post-translational Modification | |
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 83 of each chain. Disulphide bond formation between cysteine residues at positions 14 and 84, 43 and 116, and 47 and 118 |