IFN-α2

Ligand id: 4960

Name: IFN-α2

Species: Human

Peptide Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETL
LDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQES
LRSKE
Selected 3D Structures
PDB Id: 1itf
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
O-linked glycosylation of threonine residue at position 106; disulphide bond between cysteine residues at positions 1 and 98, and 29 and 138