Synonyms: interferon alpha-II-1 | interferon omega-1
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-ω is a type I IFN. In humans, only one functional form has been characterised; however, several pseudogenes are described.
Species: Human
|
Peptide Sequence | |
LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWN MTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNM QERLRSKDRDLGSS |
Selected 3D Structures | ||
|
Post-translational Modification | |
N-linked glycosylation of asparagine residue at position 80; predicted disulphide bond formation between cysteine residues at positions 3 and 101 and 31 and 141 |