IFN-ω   Click here for help

GtoPdb Ligand ID: 4970

Synonyms: interferon alpha-II-1 | interferon omega-1
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IFN-ω is a type I IFN. In humans, only one functional form has been characterised; however, several pseudogenes are described.
Species: Human
Peptide Sequence Click here for help
LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWN
MTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNM
QERLRSKDRDLGSS
Selected 3D Structures
PDB Id: 3SE4
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine residue at position 80; predicted disulphide bond formation between cysteine residues at positions 3 and 101 and 31 and 141