|
Synonyms: interleukin-9
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-9 is a pleiotropic cytokine. Th9 cells and/or the IL-9/IL-9 receptor pathway are potential targets for pharmacological intervention in atopic diseases such as asthma and ulcerative colitis.
Species: Human
|
Peptide Sequence  |
|
|
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine resdidues at positions 32, 45, 60 and 96 | |
