Abbreviated name: PSPN
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Biologically active persephin is a disulphide-linked homodimer
Species: Human
|
Peptide Sequence | |
WGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGA RTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG |
Post-translational Modification | |
Biologically active peptide is a homodimer. Predicted disulphide bond formation between cysteine residues at positions 45 and 103, 72 and 131, and 76 and 135. Predicted interchain disulphide bond between cysteine residues at position 102 of each chain |