VEGFC   Click here for help

GtoPdb Ligand ID: 5087

Synonyms: Flt4 ligand (Flt4-L) | vascular endothelial growth factor-related protein | VEGF-C
Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a non-convalent and anti-parallel homodimer linked by disulphide bonds
Species: Human
Peptide Sequence Click here for help
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVP
LSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Selected 3D Structures
PDB Id: 2X1W
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Homodimer formed by interchain disulphide bonds between cysteine residues at positions 45 and 54; further disulphide bonds formed between cysteine residues at positions 20 and 62, 51 and 108, and 55 and 100. N-linked glycosylation of asparagine residues at positions 66 and 94; predicted N-linked glycosylation of asparagine at 129