Compound class:
Peptide or derivative
Comment: Synthetic analogue of the glycoprotein hormone common alpha subunit, one of the subunit components of the the synthetic FSH analogue FSH deglycosylated α/β
|
Is a component of |
FSH deglycosylated α/β |
Peptide Sequence | |
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKQVTSESTCCVAKSYNRVTVMGGFKVEQHT ACHCSTCYYHKS |
Chemical Modification | |
Asparagine residues at positions 52 and 78 of the natural sequence which undergo glycosylation in the formation of active FSH are replaced by glutamine residues |