|
Synonyms: cristin-2 | cysteine-rich and single thrombospondin domain-containing protein 2 | mCristin-2 | roof plate-specific spondin-2
Compound class:
Endogenous peptide in human, mouse or rat
Species: Mouse
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
NRWRRNKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDS CFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKD TIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKRNKKKRRKLIERAQEQHSVFLATDRVNQ |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of aspragine residue at position 137; predicted disulphide bond formation between cysteine residues at positions 122 and 164; 133 and 140, and 173 and 180 | |
