IL-17B   Click here for help

GtoPdb Ligand ID: 5877

Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IL-17B is a proinflammatory homolog of IL-17 expressed at very high levels in spinal cord (primarily localizing to neuronal cell bodies and axons) and at lower levels in trachea, prostate, lung, small intestine, testes, adrenal, and pancreas [2-3], and acting on a restricted set of target cells (IL-17B receptor expression is restricted to human kidney, pancreas, liver, brain, and intestines [3]).
Species: Human
Peptide Sequence Click here for help
QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSP
WGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Gln-Pro-Arg-Ser-Pro-Lys-Ser-Lys-Arg-Lys-Gly-Gln-Gly-Arg-Pro-Gly-Pro-Leu-Ala-Pro-Gly-Pro-His-Gln-Val-Pro-Leu-Asp-Leu-Val-Ser-Arg-Met-Lys-Pro-Tyr-Ala-Arg-Met-Glu-Glu-Tyr-Glu-Arg-Asn-Ile-Glu-Glu-Met-Val-Ala-Gln-Leu-Arg-Asn-Ser-Ser-Glu-Leu-Ala-Gln-Arg-Lys-Cys-Glu-Val-Asn-Leu-Gln-Leu-Trp-Met-Ser-Asn-Lys-Arg-Ser-Leu-Ser-Pro-Trp-Gly-Tyr-Ser-Ile-Asn-His-Asp-Pro-Ser-Arg-Ile-Pro-Val-Asp-Leu-Pro-Glu-Ala-Arg-Cys-Leu-Cys-Leu-Gly-Cys-Val-Asn-Pro-Phe-Thr-Met-Gln-Glu-Asp-Arg-Ser-Met-Val-Ser-Val-Pro-Val-Phe-Ser-Gln-Val-Pro-Val-Arg-Arg-Arg-Leu-Cys-Pro-Pro-Pro-Pro-Arg-Thr-Gly-Pro-Cys-Arg-Gln-Arg-Ala-Val-Met-Glu-Thr-Ile-Ala-Val-Gly-Cys-Thr-Cys-Ile-Phe
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 55; predicted disulphide bond formation between cysteine residues at positions 101 and 156, and 106 and 158.