abatacept

Ligand id: 6891

Name: abatacept

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: abatacept

Peptide Sequence
MGVLLTQRTLLSLVLALLFPSMASMAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMM
GNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTH
TSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Chemical Modification
The drug is a dimeric protein, consisting of two identical subunits linked by a disulphide bridge (between Cys146 on each subunit). The sequence shown above is for a single monomer. Intra-subunit disulphide bridges form between cysteines 47-118, 74-92, 197-217 and 303-401. There are glycosylation sites at Asn102, Asn134 and Asn233. This additional structural information is taken from the INN record for the drug.