palifermin

Ligand id: 6954

Name: palifermin

Peptide Sequence
MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKEC
NEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Chemical Modification
This peptide is fibroblast growth factor 7 (amino acids 23-163) with a methionine substitution at Met23