seractide acetate

Ligand id: 6966

Name: seractide acetate

Peptide Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Chemical Modification
This is the acetate salt of human corticotropin