seractide acetate is an approved drug (FDA (1978))
Compound class:
Peptide or derivative
Comment: This peptide is the acetate salt of full length (39 amino acid) human corticotropin. It has a US approved name (USAN) but no international approved name (INN) and does not appear on the US FDA current drug list. This appears to be a discontinued injectable repository from of corticotropin. See FDA New Drug Application (NDA) 017861
|
Peptide Sequence  |
|
| SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF | |
| Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe | |
| Chemical Modification | |
| This is the acetate salt of human corticotropin | |
