corticotropin zinc hydroxide

Ligand id: 6967

Name: corticotropin zinc hydroxide

Peptide Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile