filgrastim

Ligand id: 6968

Name: filgrastim

Peptide Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEEL
VLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMA
PALQPTQGAMPAFASAFQRR AGGVLVASHLQSFLEVSYRVLRHLAQP