sermorelin

Ligand id: 6998

Name: sermorelin

Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln
Chemical Modification
Carboxy terminal amidation