metreleptin

Ligand id: 7333

Name: metreleptin

Peptide Sequence
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISND
LENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Met-Val-Pro-Ile-Gln-Lys-Val-Gln-Asp-Asp-Thr-Lys-Thr-Leu-Ile-Lys-Thr-Ile-Val-Thr-Arg-Ile-Asn-Asp-Ile-Ser-His-Thr-Gln-Ser-Val-Ser-Ser-Lys-Gln-Lys-Val-Thr-Gly-Leu-Asp-Phe-Ile-Pro-Gly-Leu-His-Pro-Ile-Leu-Thr-Leu-Ser-Lys-Met-Asp-Gln-Thr-Leu-Ala-Val-Tyr-Gln-Gln-Ile-Leu-Thr-Ser-Met-Pro-Ser-Arg-Asn-Val-Ile-Gln-Ile-Ser-Asn-Asp-Leu-Glu-Asn-Leu-Arg-Asp-Leu-Leu-His-Val-Leu-Ala-Phe-Ser-Lys-Ser-Cys(1)-His-Leu-Pro-Trp-Ala-Ser-Gly-Leu-Glu-Thr-Leu-Asp-Ser-Leu-Gly-Gly-Val-Leu-Glu-Ala-Ser-Gly-Tyr-Ser-Thr-Glu-Val-Val-Ala-Leu-Ser-Arg-Leu-Gln-Gly-Ser-Leu-Gln-Asp-Met-Leu-Trp-Gln-Leu-Asp-Leu-Ser-Pro-Gly-Cys(1)
Chemical Modification
Cysteines 97 and 147 form a disulphide bridge. The peptide is not glycosylated.