pramlintide

Ligand id: 7482

Name: pramlintide

Peptide Sequence
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr
Chemical Modification
Carboxy terminal amidated.