alpha1-proteinase inhibitor

Ligand id: 7487

Name: alpha1-proteinase inhibitor

Peptide Sequence
EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGL
NFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDY
VEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVL
LMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSG
VTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Glu-Asp-Pro-Gln-Gly-Asp-Ala-Ala-Gln-Lys-Thr-Asp-Thr-Ser-His-His-Asp-Gln-Asp-His-Pro-Thr-Phe-Asn-Lys-Ile-Thr-Pro-Asn-Leu-Ala-Glu-Phe-Ala-Phe-Ser-Leu-Tyr-Arg-Gln-Leu-Ala-His-Gln-Ser-Asn-Ser-Thr-Asn-Ile-Phe-Phe-Ser-Pro-Val-Ser-Ile-Ala-Thr-Ala-Phe-Ala-Met-Leu-Ser-Leu-Gly-Thr-Lys-Ala-Asp-Thr-His-Asp-Glu-Ile-Leu-Glu-Gly-Leu-Asn-Phe-Asn-Leu-Thr-Glu-Ile-Pro-Glu-Ala-Gln-Ile-His-Glu-Gly-Phe-Gln-Glu-Leu-Leu-Arg-Thr-Leu-Asn-Gln-Pro-Asp-Ser-Gln-Leu-Gln-Leu-Thr-Thr-Gly-Asn-Gly-Leu-Phe-Leu-Ser-Glu-Gly-Leu-Lys-Leu-Val-Asp-Lys-Phe-Leu-Glu-Asp-Val-Lys-Lys-Leu-Tyr-His-Ser-Glu-Ala-Phe-Thr-Val-Asn-Phe-Gly-Asp-Thr-Glu-Glu-Ala-Lys-Lys-Gln-Ile-Asn-Asp-Tyr-Val-Glu-Lys-Gly-Thr-Gln-Gly-Lys-Ile-Val-Asp-Leu-Val-Lys-Glu-Leu-Asp-Arg-Asp-Thr-Val-Phe-Ala-Leu-Val-Asn-Tyr-Ile-Phe-Phe-Lys-Gly-Lys-Trp-Glu-Arg-Pro-Phe-Glu-Val-Lys-Asp-Thr-Glu-Glu-Glu-Asp-Phe-His-Val-Asp-Gln-Val-Thr-Thr-Val-Lys-Val-Pro-Met-Met-Lys-Arg-Leu-Gly-Met-Phe-Asn-Ile-Gln-His-Cys-Lys-Lys-Leu-Ser-Ser-Trp-Val-Leu-Leu-Met-Lys-Tyr-Leu-Gly-Asn-Ala-Thr-Ala-Ile-Phe-Phe-Leu-Pro-Asp-Glu-Gly-Lys-Leu-Gln-His-Leu-Glu-Asn-Glu-Leu-Thr-His-Asp-Ile-Ile-Thr-Lys-Phe-Leu-Glu-Asn-Glu-Asp-Arg-Arg-Ser-Ala-Ser-Leu-His-Leu-Pro-Lys-Leu-Ser-Ile-Thr-Gly-Thr-Tyr-Asp-Leu-Lys-Ser-Val-Leu-Gly-Gln-Leu-Gly-Ile-Thr-Lys-Val-Phe-Ser-Asn-Gly-Ala-Asp-Leu-Ser-Gly-Val-Thr-Glu-Glu-Ala-Pro-Leu-Lys-Leu-Ser-Lys-Ala-Val-His-Lys-Ala-Val-Leu-Thr-Ile-Asp-Glu-Lys-Gly-Thr-Glu-Ala-Ala-Gly-Ala-Met-Phe-Leu-Glu-Ala-Ile-Pro-Met-Ser-Ile-Pro-Pro-Glu-Val-Lys-Phe-Asn-Lys-Pro-Phe-Val-Phe-Leu-Met-Ile-Glu-Gln-Asn-Thr-Lys-Ser-Pro-Leu-Phe-Met-Gly-Lys-Val-Val-Asn-Pro-Thr-Gln-Lys