CCL14   Click here for help

GtoPdb Ligand ID: 753

Synonyms: CCL14a | CKβ1 | haemofiltrate CC chemokine 1 (HCC-1) | HCC-1(1-74)
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: The ligand is cleaved from the precursor C-C motif chemokine 14 (represents residues 20-93)
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Thr-Lys-Thr-Glu-Ser-Ser-Ser-Arg-Gly-Pro-Tyr-His-Pro-Ser-Glu-Cys-Cys-Phe-Thr-Tyr-Thr-Thr-Tyr-Lys-Ile-Pro-Arg-Gln-Arg-Ile-Met-Asp-Tyr-Tyr-Glu-Thr-Asn-Ser-Gln-Cys-Ser-Lys-Pro-Gly-Ile-Val-Phe-Ile-Thr-Lys-Arg-Gly-His-Ser-Val-Cys-Thr-Asn-Pro-Ser-Asp-Lys-Trp-Val-Gln-Asp-Tyr-Ile-Lys-Asp-Met-Lys-Glu-Asn
Selected 3D Structures
PDB Id: 2Q8T
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Glycosylated CCL14 is one of the predominant forms. N-terminally truncated forms are also identified [3]. For further information see UniProt