dulaglutide

Ligand id: 7638

Name: dulaglutide

Peptide Sequence
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT
VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
Chemical Modification
The first 31 amino acids of this peptide are residues 3-37 of human GLP-1 with the following substitutions(relative to GLP-1 numbering): Ala8Gly, Gly22Glu, Arg36Gly. The next 16 amino acids (GGGGGGGSGGGGSG) are a linker sequence. The remaining 228 amino acids are a synthetic human Fc fragment (immunoglobulin G4). Two identical peptide chains form a dimer, linked by inter-monomer disulphide bonds between Cys55-55 and Cys58-58.