|
Synonyms: MC 148 | MC 148 CC chemokine
Compound class:
Peptide or derivative
Comment: A viral chemokine from Molluscum contagiosum virus. The peptide appears to exist in two forms MC148R1 and MC148R2 [2]. The sequence provided here is for MC148R2, which has GenBank protein accession number AAB72041. MC148R1 has peptide sequence MRGGDVFASV VLMLLLALPR PGVSLARRKC CLNPTNRPIP NPLLQDLSRV DYQAIGHDCG REAFRVTLQD GRQCVSVGNK SLLDWLRGHK DLCPPQIWSG CESL [2].
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
MRARAVFASVVLTLLLALPRPGVSLSRRKCCLNPTNRPIPNPLLQDLDKVDYQPMGHDCGREAFRVTLQDGRQCVSVGNQ SLLDWLKGHKDLCPRMWPGCESL |
|
