sargramostim

Ligand id: 7905

Name: sargramostim

Peptide Sequence
APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMM
ASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE