apelin receptor early endogenous ligand

Ligand id: 7930

Name: apelin receptor early endogenous ligand

Abbreviated name: ELA

Species: Human

Peptide Sequence
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro
Post-translational Modification
N-linked glycosylation at Asn5 in the peptide sequence shown here (equivalent to Asn27 in the 54 amino acid precursor).