IFN-β1a (recombinant human)

Ligand id: 8339

Name: IFN-β1a (recombinant human)

Peptide Sequence
MSYNLLGFLQRSSNFCCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL
TGYLRN
Chemical Modification
A disulphide bridge forms between Cys31 and Cys141.