IFN-β1b (recombinant human)

Ligand id: 8340

Name: IFN-β1b (recombinant human)

Peptide Sequence
MSYNLLGFLQRSSNFNCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRDSSSTGWNE
TIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLT
GYLRN
Chemical Modification
A disulphide bridge forms between Cys31 and Cys141.