|
Compound class:
Peptide or derivative
Comment: GIP(3-42)NH2 is a truncated form of gastric inhibitory polypeptide (GIP) formed through degradation by dipeptidyl peptidase IV (DPP IV). At high concentration GIP(3-42)NH2 acts as a low potency antagonist of the GIP receptor, weakly antagonizing cAMP accumulation and insulin output in vitro, but no physiological antagonism is observed in vivo [1].
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
| EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2 | |
| Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln | |
