Compound class:
Endogenous peptide in human, mouse or rat
Comment: Adropin is a peptide hormone translated form he EHNO gene [2]. Its biological function is poorly understood, but it was originally suggested to be linked to energy homeostasis and lipid metabolism [1-3].
Adropin has been suggested as an endogenous ligand for the orphan GPCR, GPR19 [4-5], although de-orphanisation requires further confirmatory evidence. The amino acid sequence of this protein in humans, mice and rats is identical.
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Post-translational Modification | |
33 amino acid signal peptide (MGAAISQGALIAIVCNGLVGFLLLLLWVILCWA) removed. |