From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

[Ile5,Trp23]PTHrP-(2-36) (human)   Click here for help

GtoPdb Ligand ID: 1799

Synonyms: [Ile5,Trp23]-PTHrP 2-36 (human)
Compound class: Peptide
Comment: Synthetic analogue of human PTHrP
Click here for help
Peptide Sequence Click here for help
VSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEI
Val-Ser-Glu-Ile-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile
Chemical Modification
Histidine residue at position 4 is substrituted by isoleucine; phenylalanine residue at position 22 is replaced by tryptophan